PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_53573g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 304aa    MW: 35462.6 Da    PI: 6.83
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_53573g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-142168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed +l +++k +G g+W++ +r+ g++R +k+c++rw++yl
    MA_53573g0010 21 RGAWTAKEDMILTEYIKTHGVGRWRSLPRKSGLKRGGKSCRLRWLNYL 68
                     89******************************99************97 PP

2Myb_DNA-binding55.61.2e-1775119248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g+ ++eE+ell++++++lG++ W++Ia +++ gRt++++k++w+++l
    MA_53573g0010  75 GNISPEEEELLIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 119
                      6779*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.0971668IPR017930Myb domain
SuperFamilySSF466891.61E-2819115IPR009057Homeodomain-like
SMARTSM007172.3E-122070IPR001005SANT/Myb domain
PfamPF002495.6E-122168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-222275IPR009057Homeodomain-like
CDDcd001673.15E-82368No hitNo description
PROSITE profilePS5129427.54269123IPR017930Myb domain
SMARTSM007172.0E-1773121IPR001005SANT/Myb domain
PfamPF002494.9E-1675119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2676123IPR009057Homeodomain-like
CDDcd001672.14E-1278119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRSPGCWSF SKDDEHEGFN RGAWTAKEDM ILTEYIKTHG VGRWRSLPRK SGLKRGGKSC  60
RLRWLNYLRP DIKHGNISPE EEELLIRLHR LLGNRWSLIA GRLPGRTDNE IKNYWNTHLR  120
KKVEISEFEP KIQKHFKNWE TPSYSDHKEE QVKDKDNCIS QSTPLKTRAD RYCGKVTDNY  180
VLKQDNHVAI NPEEEGLKAA ADHVVETDAS KSWCQLLLEE CIGDDKYDRL DVTDGLQANG  240
IVGSHSFGIE HHLHAQFYYP TCNYETNSSY PSFFEDQEFR HSKHFHFPYF ESFLDLSELP  300
SFIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241912325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLR4HES61e-115R4HES6_PICAB; TT2-like protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.12e-47myb domain protein 7